Lineage for d3i1ua_ (3i1u A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2497307Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2497308Family c.56.5.1: Pancreatic carboxypeptidases [53188] (5 proteins)
  6. 2497309Protein Carboxypeptidase A [53189] (4 species)
  7. 2497312Species Cow (Bos taurus) [TaxId:9913] [53190] (34 PDB entries)
  8. 2497314Domain d3i1ua_: 3i1u A: [178022]
    automated match to d1pytb_
    complexed with btw, gol, zn

Details for d3i1ua_

PDB Entry: 3i1u (more details), 1.39 Å

PDB Description: Carboxypeptidase A Inhibited by a Thiirane Mechanism-Based inactivator
PDB Compounds: (A:) Carboxypeptidase A1 (Pancreatic)

SCOPe Domain Sequences for d3i1ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i1ua_ c.56.5.1 (A:) Carboxypeptidase A {Cow (Bos taurus) [TaxId: 9913]}
stntfnyatyhtldeiydfmdllvaehpqlvsklqigrsyegrpiyvlkfstggsnrpai
widlgihsrewitqatgvwfakkftedygqdpsftaildsmdifleivtnpdgfafthsq
nrlwrktrsvtssslcvgvdanrnwdagfgkagassspcsetyhgkyansevevksivdf
vkdhgnfkaflsihsysqlllypygyttqsipdktelnqvaksavaalkslygtsykygs
iittiyqasggsidwsynqgikysftfelrdtgrygfllpasqiiptaqetwlgvltime
htv

SCOPe Domain Coordinates for d3i1ua_:

Click to download the PDB-style file with coordinates for d3i1ua_.
(The format of our PDB-style files is described here.)

Timeline for d3i1ua_: