Lineage for d3i1ja1 (3i1j A:1-246)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848206Species Pseudomonas syringae [TaxId:323] [188999] (1 PDB entry)
  8. 2848207Domain d3i1ja1: 3i1j A:1-246 [178020]
    Other proteins in same PDB: d3i1ja2
    automated match to d1vl8a_
    complexed with act, cl, edo, na

Details for d3i1ja1

PDB Entry: 3i1j (more details), 1.9 Å

PDB Description: Structure of a putative short chain dehydrogenase from Pseudomonas syringae
PDB Compounds: (A:) Oxidoreductase, short chain dehydrogenase/reductase family

SCOPe Domain Sequences for d3i1ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i1ja1 c.2.1.0 (A:1-246) automated matches {Pseudomonas syringae [TaxId: 323]}
mfdysahpellkgrvilvtgaargigaaaarayaahgasvvllgrteaslaevsdqiksa
gqpqpliialnlenataqqyrelaarvehefgrldgllhnasiigprtpleqlpdedfmq
vmhvnvnatfmltrallpllkrsedasiaftsssvgrkgranwgaygvskfateglmqtl
adelegvtavransinpgatrtgmraqaypdenplnnpapedimpvylylmgpdstging
qalnaq

SCOPe Domain Coordinates for d3i1ja1:

Click to download the PDB-style file with coordinates for d3i1ja1.
(The format of our PDB-style files is described here.)

Timeline for d3i1ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3i1ja2
View in 3D
Domains from other chains:
(mouse over for more information)
d3i1jb_