SCOPe 2.08: Domain d3i1ja1: 3i1j A:1-246

Lineage for d3i1ja1 (3i1j A:1-246)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Pseudomonas syringae [TaxId:323] [188999] (1 PDB entry)

8. Domain d3i1ja1: 3i1j A:1-246 [178020]
   Other proteins in same PDB: d3i1ja2
   automated match to d1vl8a_
   complexed with act, cl, edo, na

Details for d3i1ja1

PDB Entry: 3i1j, 1.9 Å

PDB Description: Structure of a putative short chain dehydrogenase from Pseudomonas syringae

PDB Compounds: (A:) Oxidoreductase, short chain dehydrogenase/reductase family

SCOPe Domain Sequences for d3i1ja1:

Sequence; same for both SEQRES and ATOM records:

>d3i1ja1 c.2.1.0 (A:1-246) automated matches {Pseudomonas syringae [TaxId: 323]}
mfdysahpellkgrvilvtgaargigaaaarayaahgasvvllgrteaslaevsdqiksa
gqpqpliialnlenataqqyrelaarvehefgrldgllhnasiigprtpleqlpdedfmq
vmhvnvnatfmltrallpllkrsedasiaftsssvgrkgranwgaygvskfateglmqtl
adelegvtavransinpgatrtgmraqaypdenplnnpapedimpvylylmgpdstging
qalnaq

Timeline for d3i1ja1:

• d3i1ja1 first appeared in SCOPe 2.01, called d3i1ja_
  
• d3i1ja1 appears in SCOPe 2.07