SCOP 1.55: Domain d1occu_: 1occ U:

Lineage for d1occu_ (1occ U:)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)

4. Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family)

5. Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)

6. Protein Cytochrome c oxidase subunit h [47696] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47697] (5 PDB entries)

8. Domain d1occu_: 1occ U: [17801]
   Other proteins in same PDB: d1occa1, d1occb1, d1occb2, d1occc1, d1occd1, d1occe_, d1occf_, d1occg1, d1occi1, d1occj1, d1occk1, d1occl1, d1occm1, d1occn1, d1occo1, d1occo2, d1occp1, d1occq1, d1occr_, d1occs_, d1occt1, d1occv1, d1occw1, d1occx1, d1occy1, d1occz1

Details for d1occu_

PDB Entry: 1occ, 2.8 Å

PDB Description: structure of bovine heart cytochrome c oxidase at the fully oxidized state

SCOP Domain Sequences for d1occu_:

Sequence; same for both SEQRES and ATOM records:

>d1occu_ a.51.1.1 (U:) Cytochrome c oxidase subunit h {Cow (Bos taurus)}
yqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpiswvs
twddrraegtfpgki

Timeline for d1occu_:

• d1occu_ appears in SCOP 1.57
  
• d1occu_ appears in the current release, SCOPe 2.08