SCOPe 2.08: Domain d3i0ta1: 3i0t A:2-166

Lineage for d3i0ta1 (3i0t A:2-166)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.359: BH3703-like [160423] (1 superfamily)
   alpha-beta(3)-alpha-beta(2)-alpha(2); antiparallel beta-sheet, order:32145; duplication: two alpha-beta(2) structural repeats are arranged with pseudo twofold symmetry

4. Superfamily d.359.1: BH3703-like [160424] (1 family)
   automatically mapped to Pfam PF04634

5. Family d.359.1.1: BH3703-like [160425] (1 protein)
   Pfam PF04634; DUF600

6. Protein Uncharacterized protein BH3703 [160426] (1 species)

7. Species Bacillus halodurans [TaxId:86665] [160427] (2 PDB entries)
   Uniprot Q9K6M5 1-166

8. Domain d3i0ta1: 3i0t A:2-166 [178009]
   Other proteins in same PDB: d3i0ta2, d3i0ta3, d3i0tb2, d3i0tb3
   automated match to d2ia1a1
   complexed with so4

Details for d3i0ta1

PDB Entry: 3i0t, 2.27 Å

PDB Description: sulfur-sad at long wavelength: structure of bh3703 from bacillus halodurans

PDB Compounds: (A:) BH3703 protein

SCOPe Domain Sequences for d3i0ta1:

Sequence; same for both SEQRES and ATOM records:

>d3i0ta1 d.359.1.1 (A:2-166) Uncharacterized protein BH3703 {Bacillus halodurans [TaxId: 86665]}
ekqiesyyqeiaqliidmipeewaevrfyaqedhdgwkifffhylsassdewtkdidird
vikvpqdefmekynelsfcisdfrkdyaeafgepwmsfqmtfyasgkfnidfyydknpfd
tfltrlawqyehfgtipedsfyketlneyleekaqgkrypflepl

Timeline for d3i0ta1:

• d3i0ta1 first appeared in SCOPe 2.01, called d3i0ta_
  
• d3i0ta1 appears in SCOPe 2.07