![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins) |
![]() | Protein automated matches [190178] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186910] (22 PDB entries) |
![]() | Domain d3i0fa_: 3i0f A: [178000] automated match to d1lz7a_ complexed with mn, u, udp |
PDB Entry: 3i0f (more details), 1.56 Å
SCOPe Domain Sequences for d3i0fa_:
Sequence, based on SEQRES records: (download)
>d3i0fa_ c.68.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ypqpkvltpsrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfaikkyvafl klfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgaykrwqdvsmrrme misdfserrflsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyerrp qsqayipkdegdfyymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyl lrhkptkvlspeylwdqqllgwpavlrklrftavpkn
>d3i0fa_ c.68.1.9 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ypqpkvltpsrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfaikkyvafl klfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevgmrrmemisdfserr flsevdylvcvdvdmefrdhvgveiltplfgtlhpsfygssreaftyerrpqsqayipkd egdfyymgaffggsvqevqrltrachqammvdqangieavwhdeshlnkyllrhkptkvl speylwdqqllgwpavlrklrftavpkn
Timeline for d3i0fa_: