Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
Fold e.26: Prismane protein-like [56820] (1 superfamily) 3 domains: (1) spectrin repeat-like 3-helical bundle; (2 and 3) alpha/beta: Rossmann-fold topology |
Superfamily e.26.1: Prismane protein-like [56821] (4 families) |
Family e.26.1.3: Acetyl-CoA synthase [82852] (3 proteins) 4 domains: structures and assembly of domains 1 and 2 are similar to those of domains 1 and 3 of the CODH subunit; (3 and 4) alpha+beta |
Protein automated matches [190423] (1 species) not a true protein |
Species Moorella thermoacetica [TaxId:1525] [187305] (3 PDB entries) |
Domain d3i04p_: 3i04 P: [177991] Other proteins in same PDB: d3i04a_, d3i04b_, d3i04c_, d3i04d_ automated match to d1mjgm_ complexed with act, cu1, cyn, gol, na, ni, sf4, xcc |
PDB Entry: 3i04 (more details), 2.15 Å
SCOPe Domain Sequences for d3i04p_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3i04p_ e.26.1.3 (P:) automated matches {Moorella thermoacetica [TaxId: 1525]} tdfdkifegaipegkepvalfrevyhgaitatsyaeillnqairtygpdhpvgypdtayy lpvircfsgeevkklgdlppilnrkraqvspvlnfenarlageatwyaaeiiealrylky kpdepllpppwtgfigdpvvrrfgikmvdwtipgeaiilgrakdskalakivkelmgmgf mlficdeaveqlleenvklgidyiayplgnftqivhaanyalragmmfggvtpgareeqr dyqrrrirafvlylgehdmvktaaafgaiftgfpvitdqplpedkqipdwffsvedydki vqiametrgikltkikldlpinfgpafegesirkgdmyvemggnrtpafelvrtvsesei tdgkievigpdidqipegsklplgilvdiygrkmqadfegvlerrihdfinygeglwhtg qrninwlrvskdavakgfrfknygeilvakmkeefpaivdrvqvtiftdeakvkeymeva rekykerddrmrgltdetvdtfyscvlcqsfapnhvcivtpervglcgavswldakasye inhagpnqpipkegeidpikgiwksvndylytasnrnleqvclytlmenpmtscgcfeai mailpecngimittrdhagmtpsgmtfstlagmigggtqtpgfmgigrtyivskkfisad ggiarivwmpkslkdflhdefvrrsveeglgedfidkiadetigttvdeilpyleekghp altmdpim
Timeline for d3i04p_: