SCOP 1.61: Domain d1ocrh_: 1ocr H:

Lineage for d1ocrh_ (1ocr H:)

1. Root: SCOP 1.61

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)

4. Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family)

5. Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)

6. Protein Cytochrome c oxidase subunit h [47696] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47697] (5 PDB entries)

8. Domain d1ocrh_: 1ocr H: [17798]
   Other proteins in same PDB: d1ocra1, d1ocrb1, d1ocrb2, d1ocrc1, d1ocrd1, d1ocre_, d1ocrf_, d1ocrg1, d1ocri1, d1ocrj1, d1ocrk1, d1ocrl1, d1ocrm1, d1ocrn1, d1ocro1, d1ocro2, d1ocrp1, d1ocrq1, d1ocrr_, d1ocrs_, d1ocrt1, d1ocrv1, d1ocrw1, d1ocrx1, d1ocry1, d1ocrz1

Details for d1ocrh_

PDB Entry: 1ocr, 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state

SCOP Domain Sequences for d1ocrh_:

Sequence; same for both SEQRES and ATOM records:

>d1ocrh_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus)}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

Timeline for d1ocrh_:

• d1ocrh_ first appeared (with stable ids) in SCOP 1.55
  
• d1ocrh_ appears in SCOP 1.59
  
• d1ocrh_ appears in SCOP 1.63
  
• d1ocrh_ appears in the current release, SCOPe 2.08