Lineage for d1ocrh_ (1ocr H:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4053Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
  4. 4054Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 4055Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)
  6. 4056Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 4057Species Cow (Bos taurus) [TaxId:9913] [47697] (5 PDB entries)
  8. 4060Domain d1ocrh_: 1ocr H: [17798]
    Other proteins in same PDB: d1ocra1, d1ocrb1, d1ocrb2, d1ocrc1, d1ocrd1, d1ocre_, d1ocrf_, d1ocrg1, d1ocri1, d1ocrj1, d1ocrk1, d1ocrl1, d1ocrm1, d1ocrn1, d1ocro1, d1ocro2, d1ocrp1, d1ocrq1, d1ocrr_, d1ocrs_, d1ocrt1, d1ocrv1, d1ocrw1, d1ocrx1, d1ocry1, d1ocrz1

Details for d1ocrh_

PDB Entry: 1ocr (more details), 2.35 Å

PDB Description: bovine heart cytochrome c oxidase in the fully reduced state
PDB Compounds: (H:)

SCOP Domain Sequences for d1ocrh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ocrh_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus)}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOP Domain Coordinates for d1ocrh_:

Click to download the PDB-style file with coordinates for d1ocrh_.
(The format of our PDB-style files is described here.)

Timeline for d1ocrh_: