Lineage for d3hzsa1 (3hzs A:68-268)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2531350Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2531351Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2533682Family d.2.1.0: automated matches [191411] (1 protein)
    not a true family
  6. 2533683Protein automated matches [190563] (18 species)
    not a true protein
  7. 2533745Species Staphylococcus aureus [TaxId:196620] [188997] (1 PDB entry)
  8. 2533746Domain d3hzsa1: 3hzs A:68-268 [177971]
    Other proteins in same PDB: d3hzsa2
    automated match to d2oqoa1
    complexed with m0e, po4

Details for d3hzsa1

PDB Entry: 3hzs (more details), 2.1 Å

PDB Description: s. aureus monofunctional glycosyltransferase (mtga)in complex with moenomycin
PDB Compounds: (A:) Monofunctional glycosyltransferase

SCOPe Domain Sequences for d3hzsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hzsa1 d.2.1.0 (A:68-268) automated matches {Staphylococcus aureus [TaxId: 196620]}
dnvdelrkienkssfvsadnmpeyvkgafismqderfynhhgfdlkgttralfstisdrd
vqggstitqqvvknyfydndrsftrkvkelfvahrvekqynkneilsfylnniyfgdnqy
tlegaanhyfgttvnknsttmshitvlqsailaskvnapsvyninnmsenftqrvstnle
kmkqqnyinetqyqqamsqln

SCOPe Domain Coordinates for d3hzsa1:

Click to download the PDB-style file with coordinates for d3hzsa1.
(The format of our PDB-style files is described here.)

Timeline for d3hzsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hzsa2