Lineage for d3hznb1 (3hzn B:1-217)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963273Fold d.90: FMN-dependent nitroreductase-like [55468] (1 superfamily)
    core: (alpha-beta-alpha-beta)2; 3 layers a/b/a; antiparallel beta-sheet: 1243
  4. 2963274Superfamily d.90.1: FMN-dependent nitroreductase-like [55469] (3 families) (S)
  5. 2963275Family d.90.1.1: NADH oxidase/flavin reductase [55470] (9 proteins)
  6. 2963381Protein automated matches [190153] (5 species)
    not a true protein
  7. 2963413Species Salmonella enterica [TaxId:99287] [188996] (1 PDB entry)
  8. 2963415Domain d3hznb1: 3hzn B:1-217 [177964]
    Other proteins in same PDB: d3hzna2, d3hznb2, d3hznc2, d3hznd2, d3hzne2, d3hznf2, d3hzng2, d3hznh2
    automated match to d1ds7a_
    complexed with act, cl, flc, mli, na, sin, tla

Details for d3hznb1

PDB Entry: 3hzn (more details), 2.4 Å

PDB Description: structure of the salmonella typhimurium nfnb dihydropteridine reductase
PDB Compounds: (B:) oxygen-insensitive nad(p)h nitroreductase

SCOPe Domain Sequences for d3hznb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hznb1 d.90.1.1 (B:1-217) automated matches {Salmonella enterica [TaxId: 99287]}
mdivsvalqrystkafdpskkltaeeadkiktllqyspsstnsqpwhfivasteegkarv
aksaagnytfnerkmldashvvvfcaktamddawlervvdqedadgrfatpeakaandkg
rrffadmhrvslkddhqwmakqvylnvgnfllgvaamgldavpiegfdaevldaefglke
kgytslvvvpvghhsvedfnaglpksrlplettltev

SCOPe Domain Coordinates for d3hznb1:

Click to download the PDB-style file with coordinates for d3hznb1.
(The format of our PDB-style files is described here.)

Timeline for d3hznb1: