Lineage for d3hzfa_ (3hzf A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1747085Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1747086Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1747087Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1747981Protein automated matches [190059] (14 species)
    not a true protein
  7. 1748003Species Human (Homo sapiens) [TaxId:9606] [187214] (138 PDB entries)
  8. 1748147Domain d3hzfa_: 3hzf A: [177962]
    automated match to d1nava_
    complexed with b72

Details for d3hzfa_

PDB Entry: 3hzf (more details), 2.5 Å

PDB Description: Structure of TR-alfa bound to selective thyromimetic GC-1 in C2 space group
PDB Compounds: (A:) Thyroid hormone receptor, alpha isoform 1 variant

SCOPe Domain Sequences for d3hzfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hzfa_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shmeemirslqqrpeptpeewdlihiateahrstnaqgshwkqrrkflpddigqspivsm
pdgdkvdleafseftkiitpaitrvvdfakklpmfselpcedqiillkgccmeimslraa
vrydpesdtltlsgemavkreqlkngglgvvsdaifelgkslsafnlddtevallqavll
mstdrsgllcvdkieksqeayllafehyvnhrkhniphfwpkllmkvtdlrmigachasr
flhmkvecptelfpplflevfed

SCOPe Domain Coordinates for d3hzfa_:

Click to download the PDB-style file with coordinates for d3hzfa_.
(The format of our PDB-style files is described here.)

Timeline for d3hzfa_: