Lineage for d2occh_ (2occ H:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4053Fold a.51: Cytochrome c oxidase subunit h [47693] (1 superfamily)
  4. 4054Superfamily a.51.1: Cytochrome c oxidase subunit h [47694] (1 family) (S)
  5. 4055Family a.51.1.1: Cytochrome c oxidase subunit h [47695] (1 protein)
  6. 4056Protein Cytochrome c oxidase subunit h [47696] (1 species)
  7. 4057Species Cow (Bos taurus) [TaxId:9913] [47697] (5 PDB entries)
  8. 4058Domain d2occh_: 2occ H: [17796]
    Other proteins in same PDB: d2occa1, d2occb1, d2occb2, d2occc1, d2occd1, d2occe_, d2occf_, d2occg1, d2occi1, d2occj1, d2occk1, d2occl1, d2occm1, d2occn1, d2occo1, d2occo2, d2occp1, d2occq1, d2occr_, d2occs_, d2occt1, d2occv1, d2occw1, d2occx1, d2occy1, d2occz1

Details for d2occh_

PDB Entry: 2occ (more details), 2.3 Å

PDB Description: bovine heart cytochrome c oxidase at the fully oxidized state
PDB Compounds: (H:)

SCOP Domain Sequences for d2occh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2occh_ a.51.1.1 (H:) Cytochrome c oxidase subunit h {Cow (Bos taurus)}
kiknyqtapfdsrfpnqnqtrncwqnyldfhrcekamtakggdvsvcewyrrvykslcpi
swvstwddrraegtfpgki

SCOP Domain Coordinates for d2occh_:

Click to download the PDB-style file with coordinates for d2occh_.
(The format of our PDB-style files is described here.)

Timeline for d2occh_: