Lineage for d3hzaa_ (3hza A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 964422Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 964543Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 964544Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 964688Protein automated matches [190798] (2 species)
    not a true protein
  7. 964689Species Mycobacterium tuberculosis [TaxId:1773] [189128] (4 PDB entries)
  8. 964690Domain d3hzaa_: 3hza A: [177951]
    automated match to d1sixa_
    complexed with dup, gol, mg, trs; mutant

Details for d3hzaa_

PDB Entry: 3hza (more details), 1.2 Å

PDB Description: crystal structure of dutpase h145w mutant
PDB Compounds: (A:) deoxyuridine 5'-triphosphate nucleotidohydrolase

SCOPe Domain Sequences for d3hzaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hzaa_ b.85.4.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
glvprgshmsttlaivrldpglplpsrahdgdagvdlysaedvelapgrralvrtgvava
vpfgmvglvhprsglatrvglsivnspgtidagyrgeikvalinldpaapivvhrgdria
qllvqrvelvelvevssfdeaglastsrgdggwgssgghasl

SCOPe Domain Coordinates for d3hzaa_:

Click to download the PDB-style file with coordinates for d3hzaa_.
(The format of our PDB-style files is described here.)

Timeline for d3hzaa_: