SCOPe 2.08: Domain d3hyub_: 3hyu B:

Lineage for d3hyub_ (3hyu B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (43 species)
   not a true protein

7. Species Guinea pig (Cavia porcellus) [TaxId:10141] [189281] (2 PDB entries)

8. Domain d3hyub_: 3hyu B: [177950]
   automated match to d1fhjb_
   complexed with hem, po4

Details for d3hyub_

PDB Entry: 3hyu, 1.67 Å

PDB Description: Crystal structure of the altitude adapted hemoglobin of guinea pig.

PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3hyub_:

Sequence; same for both SEQRES and ATOM records:

>d3hyub_ a.1.1.2 (B:) automated matches {Guinea pig (Cavia porcellus) [TaxId: 10141]}
vhltaaeksaildlwgkvnvgeigaealgrllvvypwtqrffekfgdlssasaimsnahv
kshgakvlasfseglkhlqdlkgtfaklselhcdklhvdpenfrllgnmivialahhhps
eftpctqaafqkvtagvanalahkyh

Timeline for d3hyub_:

• d3hyub_ first appeared in SCOPe 2.01
  
• d3hyub_ appears in SCOPe 2.07