SCOPe 2.03: Domain d3hykc_: 3hyk C:

Lineage for d3hykc_ (3hyk C:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.0: automated matches [191589] (1 protein)
   not a true family

6. Protein automated matches [191061] (6 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188950] (1 PDB entry)

8. Domain d3hykc_: 3hyk C: [177947]
   automated match to d1f80a_
   complexed with a3p, cl, mg

Details for d3hykc_

PDB Entry: 3hyk, 2.31 Å

PDB Description: 2.31 angstrom resolution crystal structure of a holo-(acyl-carrier- protein) synthase from bacillus anthracis str. ames in complex with coa (3',5'-adp)

PDB Compounds: (C:) Holo-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d3hykc_:

Sequence, based on SEQRES records:

>d3hykc_ d.150.1.0 (C:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
amivgigidiielnriekmldgklkfmeriltenernvakglkgsrltefvagrfaakea
yskavgtgigkevsfldievrnddrgkpilitstehivhlsishskefavaqvvlesss

Sequence, based on observed residues (ATOM records):

>d3hykc_ d.150.1.0 (C:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
amivgigidiielnriekmldkfmeriltenernvakglkgsrltefvagrfaakeaysk
avgtgigkevsfldievrnddrgkpilitstehivhlsishskefavaqvvlesss

Timeline for d3hykc_:

• d3hykc_ first appeared in SCOPe 2.01
  
• d3hykc_ appears in SCOPe 2.02
  
• d3hykc_ appears in SCOPe 2.04
  
• d3hykc_ appears in the current release, SCOPe 2.08, called d3hykc1