Lineage for d3hykb_ (3hyk B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934100Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 1934101Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 1934134Family d.150.1.0: automated matches [191589] (1 protein)
    not a true family
  6. 1934135Protein automated matches [191061] (9 species)
    not a true protein
  7. 1934136Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188950] (1 PDB entry)
  8. 1934138Domain d3hykb_: 3hyk B: [177946]
    automated match to d1f80a_
    complexed with a3p, cl, mg

Details for d3hykb_

PDB Entry: 3hyk (more details), 2.31 Å

PDB Description: 2.31 angstrom resolution crystal structure of a holo-(acyl-carrier- protein) synthase from bacillus anthracis str. ames in complex with coa (3',5'-adp)
PDB Compounds: (B:) Holo-[acyl-carrier-protein] synthase

SCOPe Domain Sequences for d3hykb_:

Sequence, based on SEQRES records: (download)

>d3hykb_ d.150.1.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
amivgigidiielnriekmldgklkfmeriltenernvakglkgsrltefvagrfaakea
yskavgtgigkevsfldievrnddrgkpilitstehivhlsishskefavaqvvless

Sequence, based on observed residues (ATOM records): (download)

>d3hykb_ d.150.1.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
amivgigidiielnriekmldkfmeriltenernvakglkgsrltefvagrfaakeaysk
avgtgigkevsfldievrnddrgkpilitstehivhlsishskefavaqvvless

SCOPe Domain Coordinates for d3hykb_:

Click to download the PDB-style file with coordinates for d3hykb_.
(The format of our PDB-style files is described here.)

Timeline for d3hykb_: