Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
Family d.150.1.0: automated matches [191589] (1 protein) not a true family |
Protein automated matches [191061] (9 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188950] (1 PDB entry) |
Domain d3hyka_: 3hyk A: [177945] automated match to d1f80a_ complexed with a3p, cl, mg |
PDB Entry: 3hyk (more details), 2.31 Å
SCOPe Domain Sequences for d3hyka_:
Sequence, based on SEQRES records: (download)
>d3hyka_ d.150.1.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} namivgigidiielnriekmldgklkfmeriltenernvakglkgsrltefvagrfaake ayskavgtgigkevsfldievrnddrgkpilitstehivhlsishskefavaqvvlesss
>d3hyka_ d.150.1.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} namivgigidiielnriekmldkfmeriltenernvakglkgsrltefvagrfaakeays kavgtgigkevsfldievrnddrgkpilitstehivhlsishskefavaqvvlesss
Timeline for d3hyka_: