SCOPe 2.01: Domain d3hyfa_: 3hyf A:

Lineage for d3hyfa_ (3hyf A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein automated matches [190266] (11 species)
   not a true protein

7. Species Human immunodeficiency virus 1, escherichia coli [TaxId:11676] [189090] (1 PDB entry)

8. Domain d3hyfa_: 3hyf A: [177942]
   automated match to d1o1wa_
   complexed with act, gol, mn, on1

Details for d3hyfa_

PDB Entry: 3hyf, 1.7 Å

PDB Description: crystal structure of hiv-1 rnase h p15 with engineered e. coli loop and active site inhibitor

PDB Compounds: (A:) Reverse transcriptase/RNaseH

SCOPe Domain Sequences for d3hyfa_:

Sequence, based on SEQRES records:

>d3hyfa_ c.55.3.1 (A:) automated matches {Human immunodeficiency virus 1, escherichia coli [TaxId: 11676]}
myqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiyla
lqdsglevnivtdsqyalgiitqwihnwkkrgwktadkkpvknvdlvnqiieqlikkekv
ylawvpahkgiggneqvdklvsagirkvl

Sequence, based on observed residues (ATOM records):

>d3hyfa_ c.55.3.1 (A:) automated matches {Human immunodeficiency virus 1, escherichia coli [TaxId: 11676]}
myqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiyla
lqdsglevnivtdsqyalgiitqwihnwkkrgwpvknvdlvnqiieqlikkekvylawvp
ahkgiggneqvdklvsagirkvl

Timeline for d3hyfa_:

• d3hyfa_ is new in SCOPe 2.01-stable
  
• d3hyfa_ appears in SCOPe 2.02
  
• d3hyfa_ appears in the current release, SCOPe 2.08, called d3hyfa1