Lineage for d3hyfa1 (3hyf A:427-560)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2885834Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 2886080Protein automated matches [190266] (7 species)
    not a true protein
  7. 2886087Species Escherichia coli [TaxId:562] [188270] (5 PDB entries)
  8. 2886091Domain d3hyfa1: 3hyf A:427-560 [177942]
    Other proteins in same PDB: d3hyfa2
    automated match to d1o1wa_
    complexed with act, gol, mn, on1

Details for d3hyfa1

PDB Entry: 3hyf (more details), 1.7 Å

PDB Description: crystal structure of hiv-1 rnase h p15 with engineered e. coli loop and active site inhibitor
PDB Compounds: (A:) Reverse transcriptase/RNaseH

SCOPe Domain Sequences for d3hyfa1:

Sequence, based on SEQRES records: (download)

>d3hyfa1 c.55.3.1 (A:427-560) automated matches {Escherichia coli [TaxId: 562]}
yqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylal
qdsglevnivtdsqyalgiitqwihnwkkrgwktadkkpvknvdlvnqiieqlikkekvy
lawvpahkgiggneqvdklvsagirkvl

Sequence, based on observed residues (ATOM records): (download)

>d3hyfa1 c.55.3.1 (A:427-560) automated matches {Escherichia coli [TaxId: 562]}
yqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylal
qdsglevnivtdsqyalgiitqwihnwkkrgwpvknvdlvnqiieqlikkekvylawvpa
hkgiggneqvdklvsagirkvl

SCOPe Domain Coordinates for d3hyfa1:

Click to download the PDB-style file with coordinates for d3hyfa1.
(The format of our PDB-style files is described here.)

Timeline for d3hyfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hyfa2