SCOPe 2.08: Domain d3hyfa1: 3hyf A:427-560

Lineage for d3hyfa1 (3hyf A:427-560)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.1: Ribonuclease H [53099] (5 proteins)

6. Protein automated matches [190266] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188270] (5 PDB entries)

8. Domain d3hyfa1: 3hyf A:427-560 [177942]
   Other proteins in same PDB: d3hyfa2
   automated match to d1o1wa_
   complexed with act, gol, mn, on1

Details for d3hyfa1

PDB Entry: 3hyf, 1.7 Å

PDB Description: crystal structure of hiv-1 rnase h p15 with engineered e. coli loop and active site inhibitor

PDB Compounds: (A:) Reverse transcriptase/RNaseH

SCOPe Domain Sequences for d3hyfa1:

Sequence, based on SEQRES records:

>d3hyfa1 c.55.3.1 (A:427-560) automated matches {Escherichia coli [TaxId: 562]}
yqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylal
qdsglevnivtdsqyalgiitqwihnwkkrgwktadkkpvknvdlvnqiieqlikkekvy
lawvpahkgiggneqvdklvsagirkvl

Sequence, based on observed residues (ATOM records):

>d3hyfa1 c.55.3.1 (A:427-560) automated matches {Escherichia coli [TaxId: 562]}
yqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylal
qdsglevnivtdsqyalgiitqwihnwkkrgwpvknvdlvnqiieqlikkekvylawvpa
hkgiggneqvdklvsagirkvl

Timeline for d3hyfa1:

• d3hyfa1 first appeared in SCOPe 2.01, called d3hyfa_
  
• d3hyfa1 appears in SCOPe 2.07