Lineage for d1c5aa_ (1c5a A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714706Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2714707Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) (S)
  5. 2714708Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
    can be classified as disulfide-rich
    Pfam PF01821
  6. 2714712Protein C5a anaphylotoxin [47688] (2 species)
  7. 2714724Species Pig (Sus scrofa) [TaxId:9823] [47690] (1 PDB entry)
  8. 2714725Domain d1c5aa_: 1c5a A: [17794]

Details for d1c5aa_

PDB Entry: 1c5a (more details)

PDB Description: three-dimensional structure of porcine c5ades*arg from 1h nuclear magnetic resonance data
PDB Compounds: (A:) complement c5a anaphylatoxin

SCOPe Domain Sequences for d1c5aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c5aa_ a.50.1.1 (A:) C5a anaphylotoxin {Pig (Sus scrofa) [TaxId: 9823]}
mlqkkieeeaakykyamlkkccydgayrnddetceeraarikigpkcvkafkdccyianq
vraeqs

SCOPe Domain Coordinates for d1c5aa_:

Click to download the PDB-style file with coordinates for d1c5aa_.
(The format of our PDB-style files is described here.)

Timeline for d1c5aa_: