SCOPe 2.06: Domain d3hyej_: 3hye J:

Lineage for d3hyej_ (3hye J:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (6 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (174 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3hyej_: 3hye J: [177926]
   Other proteins in same PDB: d3hyea_, d3hyeb_, d3hyec_, d3hyee_, d3hyef_, d3hyeg_, d3hyeo_, d3hyep_, d3hyeq_, d3hyes_, d3hyet_, d3hyeu_
   automated match to d1g0uj_
   complexed with hye

Details for d3hyej_

PDB Entry: 3hye, 2.5 Å

PDB Description: Crystal structure of 20S proteasome in complex with hydroxylated salinosporamide

PDB Compounds: (J:) Proteasome component C11

SCOPe Domain Sequences for d3hyej_:

Sequence; same for both SEQRES and ATOM records:

>d3hyej_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdiilgirvqdsvilasskavtrgisvlkdsddktrqlsphtlmsfageagdtvqfaeyi
qaniqlysiredyelspqavssfvrqelaksirsrrpyqvnvliggydkkknkpelyqid
ylgtkvelpygahgysgfytfslldhhyrpdmtteegldllklcvqelekrmpmdfkgvi
vkivdkdgirqvddfqaq

Timeline for d3hyej_:

• d3hyej_ first appeared in SCOPe 2.01
  
• d3hyej_ appears in SCOPe 2.05
  
• d3hyej_ appears in SCOPe 2.07
  
• d3hyej_ appears in the current release, SCOPe 2.08