Lineage for d1kjsa_ (1kjs A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327856Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2327857Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) (S)
  5. 2327858Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
    can be classified as disulfide-rich
    Pfam PF01821
  6. 2327862Protein C5a anaphylotoxin [47688] (2 species)
  7. 2327863Species Human (Homo sapiens) [TaxId:9606] [47689] (5 PDB entries)
  8. 2327873Domain d1kjsa_: 1kjs A: [17792]

Details for d1kjsa_

PDB Entry: 1kjs (more details)

PDB Description: nmr solution structure of c5a at ph 5.2, 303k, 20 structures
PDB Compounds: (A:) c5a

SCOPe Domain Sequences for d1kjsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjsa_ a.50.1.1 (A:) C5a anaphylotoxin {Human (Homo sapiens) [TaxId: 9606]}
mlqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasq
lranishkdmqlgr

SCOPe Domain Coordinates for d1kjsa_:

Click to download the PDB-style file with coordinates for d1kjsa_.
(The format of our PDB-style files is described here.)

Timeline for d1kjsa_: