Lineage for d1kjs__ (1kjs -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4041Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
  4. 4042Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) (S)
  5. 4043Family a.50.1.1: Anaphylotoxins (complement system) [47687] (2 proteins)
  6. 4047Protein C5a anaphylotoxin [47688] (2 species)
  7. 4048Species Human (Homo sapiens) [TaxId:9606] [47689] (2 PDB entries)
  8. 4050Domain d1kjs__: 1kjs - [17792]

Details for d1kjs__

PDB Entry: 1kjs (more details)

PDB Description: nmr solution structure of c5a at ph 5.2, 303k, 20 structures

SCOP Domain Sequences for d1kjs__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjs__ a.50.1.1 (-) C5a anaphylotoxin {Human (Homo sapiens)}
mlqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasq
lranishkdmqlgr

SCOP Domain Coordinates for d1kjs__:

Click to download the PDB-style file with coordinates for d1kjs__.
(The format of our PDB-style files is described here.)

Timeline for d1kjs__: