Lineage for d1kjsa1 (1kjs A:2-74)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714706Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2714707Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) (S)
  5. 2714708Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
    can be classified as disulfide-rich
    Pfam PF01821
  6. 2714712Protein C5a anaphylotoxin [47688] (2 species)
  7. 2714713Species Human (Homo sapiens) [TaxId:9606] [47689] (5 PDB entries)
  8. 2714723Domain d1kjsa1: 1kjs A:2-74 [17792]
    Other proteins in same PDB: d1kjsa2

Details for d1kjsa1

PDB Entry: 1kjs (more details)

PDB Description: nmr solution structure of c5a at ph 5.2, 303k, 20 structures
PDB Compounds: (A:) c5a

SCOPe Domain Sequences for d1kjsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kjsa1 a.50.1.1 (A:2-74) C5a anaphylotoxin {Human (Homo sapiens) [TaxId: 9606]}
lqkkieeiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasql
ranishkdmqlgr

SCOPe Domain Coordinates for d1kjsa1:

Click to download the PDB-style file with coordinates for d1kjsa1.
(The format of our PDB-style files is described here.)

Timeline for d1kjsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kjsa2