SCOPe 2.08: Domain d3hyeb_: 3hye B:

Lineage for d3hyeb_ (3hye B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (240 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3hyeb_: 3hye B: [177919]
   Other proteins in same PDB: d3hye1_, d3hye2_, d3hyed_, d3hyeg_, d3hyeh_, d3hyei_, d3hyej_, d3hyek_, d3hyel_, d3hyem_, d3hyen_, d3hyer_, d3hyeu_, d3hyev_, d3hyew_, d3hyex_, d3hyey_, d3hyez_
   automated match to d1g65b_
   complexed with hye

Details for d3hyeb_

PDB Entry: 3hye, 2.5 Å

PDB Description: Crystal structure of 20S proteasome in complex with hydroxylated salinosporamide

PDB Compounds: (B:) Proteasome component Y13

SCOPe Domain Sequences for d3hyeb_:

Sequence; same for both SEQRES and ATOM records:

>d3hyeb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

Timeline for d3hyeb_:

• d3hyeb_ first appeared in SCOPe 2.01
  
• d3hyeb_ appears in SCOPe 2.07