Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.268: ParB/Sulfiredoxin [110848] (1 superfamily) beta*-alpha-beta(2)-alpha-beta-alpha; mixed beta sheet forms a partly open barrel: (n*=4, S*=8) |
Superfamily d.268.1: ParB/Sulfiredoxin [110849] (4 families) |
Family d.268.1.4: Sulfiredoxin-like [160095] (2 proteins) PfamB PB015736 |
Protein automated matches [190893] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188310] (1 PDB entry) |
Domain d3hy2x_: 3hy2 X: [177911] Other proteins in same PDB: d3hy2a_, d3hy2b_ automated match to d1xw4x1 complexed with atp, mg |
PDB Entry: 3hy2 (more details), 2.1 Å
SCOPe Domain Sequences for d3hy2x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hy2x_ d.268.1.4 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]} riaavhcvplsvlirplpsvldpakvqslvdtiredpdsvppidvlwikgaqggdyfysf ggahryaayqqlqretipaklvqstlsdlrvylgastpdlq
Timeline for d3hy2x_: