Lineage for d1f6va1 (1f6v A:2-91)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998058Fold a.49: C-terminal domain of B transposition protein [47680] (1 superfamily)
    4 helices; irregular array
  4. 1998059Superfamily a.49.1: C-terminal domain of B transposition protein [47681] (1 family) (S)
    automatically mapped to Pfam PF09077
  5. 1998060Family a.49.1.1: C-terminal domain of B transposition protein [47682] (1 protein)
  6. 1998061Protein C-terminal domain of B transposition protein [47683] (1 species)
  7. 1998062Species Bacteriophage Mu [TaxId:10677] [47684] (1 PDB entry)
  8. 1998063Domain d1f6va1: 1f6v A:2-91 [17791]
    Other proteins in same PDB: d1f6va2

Details for d1f6va1

PDB Entry: 1f6v (more details)

PDB Description: solution structure of the c terminal of mu b transposition protein
PDB Compounds: (A:) DNA transposition protein

SCOPe Domain Sequences for d1f6va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6va1 a.49.1.1 (A:2-91) C-terminal domain of B transposition protein {Bacteriophage Mu [TaxId: 10677]}
sriakrtainktkkadvkaiadawqingekelellqqiaqkpgalrilnhslrlaamtah
gkgervnedylrqafreldldvdistllrn

SCOPe Domain Coordinates for d1f6va1:

Click to download the PDB-style file with coordinates for d1f6va1.
(The format of our PDB-style files is described here.)

Timeline for d1f6va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f6va2