Lineage for d3hxoa_ (3hxo A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892194Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2892195Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 2892196Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins)
  6. 2892325Protein von Willebrand factor A1 domain, vWA1 [53306] (2 species)
  7. 2892326Species Human (Homo sapiens) [TaxId:9606] [53307] (11 PDB entries)
  8. 2892336Domain d3hxoa_: 3hxo A: [177909]
    automated match to d1auqa_
    protein/DNA complex

Details for d3hxoa_

PDB Entry: 3hxo (more details), 2.4 Å

PDB Description: crystal structure of von willebrand factor (vwf) a1 domain in complex with dna aptamer arc1172, an inhibitor of vwf-platelet binding
PDB Compounds: (A:) von willebrand factor

SCOPe Domain Sequences for d3hxoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hxoa_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]}
fycsrlldlvflldgssrlseaefevlkafvvdmmerlrisqkwvrvavveyhdgshayi
glkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrialllmasqe
pqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlssvdeleqq
rdeivsylcdlapeapppt

SCOPe Domain Coordinates for d3hxoa_:

Click to download the PDB-style file with coordinates for d3hxoa_.
(The format of our PDB-style files is described here.)

Timeline for d3hxoa_: