Lineage for d1eo0a_ (1eo0 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327716Fold a.48: N-cbl like [47667] (5 superfamilies)
    4 helices; bundle, left-handed twist; left-handed superhelix
  4. 2327805Superfamily a.48.3: Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 [47676] (1 family) (S)
  5. 2327806Family a.48.3.1: Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 [47677] (2 proteins)
    Smart 00509
  6. 2327810Protein Transcription elongation factor TFIIS N-domain [47678] (1 species)
  7. 2327811Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47679] (1 PDB entry)
  8. 2327812Domain d1eo0a_: 1eo0 A: [17790]

Details for d1eo0a_

PDB Entry: 1eo0 (more details)

PDB Description: conserved domain common to transcription factors tfiis, elongin a, crsp70
PDB Compounds: (A:) transcription elongation factor s-II

SCOPe Domain Sequences for d1eo0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eo0a_ a.48.3.1 (A:) Transcription elongation factor TFIIS N-domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdskevlvhvknleknksndaavleilhvldkefvptekllretkvgvevnkfkkstnve
isklvkkmisswkdain

SCOPe Domain Coordinates for d1eo0a_:

Click to download the PDB-style file with coordinates for d1eo0a_.
(The format of our PDB-style files is described here.)

Timeline for d1eo0a_: