Lineage for d1eo0a_ (1eo0 A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.48: N-cbl like [47667] (3 superfamilies) 
Superfamily a.48.3: Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 [47676] (1 family) 
Family a.48.3.1: Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 [47677] (1 protein) Protein Transcription elongation factor TFIIS N-domain [47678] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47679] (1 PDB entry) 
Domain d1eo0a_: 1eo0 A: [17790]
Details for d1eo0a_
PDB Entry: 1eo0 (more details)
PDB Description: conserved domain common to transcription factors tfiis, elongin a, crsp70
SCOP Domain Sequences for d1eo0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eo0a_ a.48.3.1 (A:) Transcription elongation factor TFIIS N-domain {Baker's yeast (Saccharomyces cerevisiae)}
mdskevlvhvknleknksndaavleilhvldkefvptekllretkvgvevnkfkkstnve
isklvkkmisswkdain
SCOP Domain Coordinates for d1eo0a_:
Click to download the PDB-style file with coordinates for d1eo0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eo0a_:
- d1eo0a_ appears in SCOP 1.57
- d1eo0a_ appears in the current release, SCOPe 2.08
View in 3D