![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.48: N-cbl like [47667] (5 superfamilies) 4 helices; bundle, left-handed twist; left-handed superhelix |
![]() | Superfamily a.48.3: Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 [47676] (1 family) ![]() |
![]() | Family a.48.3.1: Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 [47677] (2 proteins) Smart 00509 |
![]() | Protein Transcription elongation factor TFIIS N-domain [47678] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47679] (1 PDB entry) |
![]() | Domain d1eo0a_: 1eo0 A: [17790] |
PDB Entry: 1eo0 (more details)
SCOPe Domain Sequences for d1eo0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eo0a_ a.48.3.1 (A:) Transcription elongation factor TFIIS N-domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mdskevlvhvknleknksndaavleilhvldkefvptekllretkvgvevnkfkkstnve isklvkkmisswkdain
Timeline for d1eo0a_: