Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.1: PCD-like [55248] (2 families) has additional alpha helix at the N-terminus |
Family d.74.1.1: PCD-like [55249] (3 proteins) Pfam PF01329 |
Protein automated matches [191183] (3 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [189442] (1 PDB entry) |
Domain d3hxag_: 3hxa G: [177896] automated match to d1f93a_ complexed with gol, so4 |
PDB Entry: 3hxa (more details), 1.8 Å
SCOPe Domain Sequences for d3hxag_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hxag_ d.74.1.1 (G:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} ahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmsrvalqaekldhhp ewfnvynkvhitlsthecaglserdinlasfieqvavsm
Timeline for d3hxag_: