Lineage for d3hxad_ (3hxa D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564740Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2564741Superfamily d.74.1: PCD-like [55248] (2 families) (S)
    has additional alpha helix at the N-terminus
  5. 2564742Family d.74.1.1: PCD-like [55249] (3 proteins)
    Pfam PF01329
  6. 2564781Protein automated matches [191183] (3 species)
    not a true protein
  7. 2564787Species Norway rat (Rattus norvegicus) [TaxId:10116] [189442] (1 PDB entry)
  8. 2564791Domain d3hxad_: 3hxa D: [177893]
    automated match to d1f93a_
    complexed with gol, so4

Details for d3hxad_

PDB Entry: 3hxa (more details), 1.8 Å

PDB Description: crystal structure of dcoh1thr51ser
PDB Compounds: (D:) Pterin-4-alpha-carbinolamine dehydratase

SCOPe Domain Sequences for d3hxad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hxad_ d.74.1.1 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmsrvalqaekldhh
pewfnvynkvhitlsthecaglserdinlasfieqvavsm

SCOPe Domain Coordinates for d3hxad_:

Click to download the PDB-style file with coordinates for d3hxad_.
(The format of our PDB-style files is described here.)

Timeline for d3hxad_: