Lineage for d3hxab_ (3hxa B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958013Superfamily d.74.1: PCD-like [55248] (2 families) (S)
    has additional alpha helix at the N-terminus
  5. 2958014Family d.74.1.1: PCD-like [55249] (3 proteins)
    Pfam PF01329
  6. 2958053Protein automated matches [191183] (3 species)
    not a true protein
  7. 2958059Species Norway rat (Rattus norvegicus) [TaxId:10116] [189442] (1 PDB entry)
  8. 2958061Domain d3hxab_: 3hxa B: [177891]
    automated match to d1f93a_
    complexed with gol, so4

Details for d3hxab_

PDB Entry: 3hxa (more details), 1.8 Å

PDB Description: crystal structure of dcoh1thr51ser
PDB Compounds: (B:) Pterin-4-alpha-carbinolamine dehydratase

SCOPe Domain Sequences for d3hxab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hxab_ d.74.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ahrlsaeerdqllpnlravgwnelegrdaifkqfhfkdfnrafgfmsrvalqaekldhhp
ewfnvynkvhitlsthecaglserdinlasfieqvavsm

SCOPe Domain Coordinates for d3hxab_:

Click to download the PDB-style file with coordinates for d3hxab_.
(The format of our PDB-style files is described here.)

Timeline for d3hxab_: