SCOPe 2.08: Domain d3hw7b_: 3hw7 B:

Lineage for d3hw7b_ (3hw7 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Cow (Bos taurus) [TaxId:9913] [49332] (23 PDB entries)

8. Domain d3hw7b_: 3hw7 B: [177888]
   automated match to d1cbja_
   complexed with cu, cu1, zn

Details for d3hw7b_

PDB Entry: 3hw7, 2 Å

PDB Description: High pressure (0.57 GPa) crystal structure of bovine copper, zinc superoxide dismutase at 2.0 angstroms

PDB Compounds: (B:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d3hw7b_:

Sequence; same for both SEQRES and ATOM records:

>d3hw7b_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

Timeline for d3hw7b_:

• d3hw7b_ first appeared in SCOPe 2.01
  
• d3hw7b_ appears in SCOPe 2.07