| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
| Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
| Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
| Species Cow (Bos taurus) [TaxId:9913] [49332] (23 PDB entries) |
| Domain d3hw7b_: 3hw7 B: [177888] automated match to d1cbja_ complexed with cu, cu1, zn |
PDB Entry: 3hw7 (more details), 2 Å
SCOPe Domain Sequences for d3hw7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hw7b_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak
Timeline for d3hw7b_: