Lineage for d3hw7a_ (3hw7 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2763729Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2763770Species Cow (Bos taurus) [TaxId:9913] [49332] (23 PDB entries)
  8. 2763795Domain d3hw7a_: 3hw7 A: [177887]
    automated match to d1cbja_
    complexed with cu, cu1, zn

Details for d3hw7a_

PDB Entry: 3hw7 (more details), 2 Å

PDB Description: High pressure (0.57 GPa) crystal structure of bovine copper, zinc superoxide dismutase at 2.0 angstroms
PDB Compounds: (A:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d3hw7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hw7a_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Cow (Bos taurus) [TaxId: 9913]}
atkavcvlkgdgpvqgtihfeakgdtvvvtgsitgltegdhgfhvhqfgdntqgctsagp
hfnplskkhggpkdeerhvgdlgnvtadkngvaivdivdplislsgeysiigrtmvvhek
pddlgrggneestktgnagsrlacgvigiak

SCOPe Domain Coordinates for d3hw7a_:

Click to download the PDB-style file with coordinates for d3hw7a_.
(The format of our PDB-style files is described here.)

Timeline for d3hw7a_: