Lineage for d3hvxc_ (3hvx C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877709Protein Thiol peroxidase Tpx [102452] (4 species)
  7. 2877710Species Escherichia coli K-12 [TaxId:83333] [189089] (4 PDB entries)
  8. 2877716Domain d3hvxc_: 3hvx C: [177882]
    automated match to d1qxha_
    complexed with cl; mutant

Details for d3hvxc_

PDB Entry: 3hvx (more details), 2.12 Å

PDB Description: escherichia coli thiol peroxidase (tpx) resolving cysteine to serine mutant (c95s) with an intermolecular disulfide bond
PDB Compounds: (C:) Thiol Peroxidase

SCOPe Domain Sequences for d3hvxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hvxc_ c.47.1.10 (C:) Thiol peroxidase Tpx {Escherichia coli K-12 [TaxId: 83333]}
sqtvhfqgnpvtvansipqagskaqtftlvakdlsdvtlgqfagkrkvlnifpsidtgvc
aasvrkfnqlateidntvvlsisadlpfaqsrfsgaeglnnvitlstfrnaeflqaygva
iadgplkglaaravvvidendnvifsqlvdeittepdyeaalavlka

SCOPe Domain Coordinates for d3hvxc_:

Click to download the PDB-style file with coordinates for d3hvxc_.
(The format of our PDB-style files is described here.)

Timeline for d3hvxc_: