Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Thiol peroxidase Tpx [102452] (4 species) |
Species Escherichia coli K-12 [TaxId:83333] [189089] (4 PDB entries) |
Domain d3hvxb_: 3hvx B: [177881] automated match to d1qxha_ complexed with cl; mutant |
PDB Entry: 3hvx (more details), 2.12 Å
SCOPe Domain Sequences for d3hvxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hvxb_ c.47.1.10 (B:) Thiol peroxidase Tpx {Escherichia coli K-12 [TaxId: 83333]} sqtvhfqgnpvtvansipqagskaqtftlvakdlsdvtlgqfagkrkvlnifpsidtgvc aasvrkfnqlateidntvvlsisadlpfaqsrfsgaeglnnvitlstfrnaeflqaygva iadgplkglaaravvvidendnvifsqlvdeittepdyeaalavlka
Timeline for d3hvxb_: