Lineage for d3hvva_ (3hvv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877709Protein Thiol peroxidase Tpx [102452] (4 species)
  7. 2877710Species Escherichia coli K-12 [TaxId:83333] [189089] (4 PDB entries)
  8. 2877711Domain d3hvva_: 3hvv A: [177879]
    automated match to d1qxha_
    mutant

Details for d3hvva_

PDB Entry: 3hvv (more details), 1.75 Å

PDB Description: escherichia coli thiol peroxidase (tpx) peroxidatic cysteine to serine mutant (c61s)
PDB Compounds: (A:) Thiol Peroxidase

SCOPe Domain Sequences for d3hvva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hvva_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli K-12 [TaxId: 83333]}
sqtvhfqgnpvtvansipqagskaqtftlvakdlsdvtlgqfagkrkvlnifpsidtgvs
aasvrkfnqlateidntvvlcisadlpfaqsrfcgaeglnnvitlstfrnaeflqaygva
iadgplkglaaravvvidendnvifsqlvdeittepdyeaalavlka

SCOPe Domain Coordinates for d3hvva_:

Click to download the PDB-style file with coordinates for d3hvva_.
(The format of our PDB-style files is described here.)

Timeline for d3hvva_: