| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
| Protein Thiol peroxidase Tpx [102452] (4 species) |
| Species Escherichia coli K-12 [TaxId:83333] [189089] (4 PDB entries) |
| Domain d3hvsb_: 3hvs B: [177878] automated match to d1qxha_ complexed with cit |
PDB Entry: 3hvs (more details), 1.8 Å
SCOPe Domain Sequences for d3hvsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hvsb_ c.47.1.10 (B:) Thiol peroxidase Tpx {Escherichia coli K-12 [TaxId: 83333]}
sqtvhfqgnpvtvansipqagskaqtftlvakdlsdvtlgqfagkrkvlnifpsidtgvc
aasvrkfnqlateidntvvlcisadlpfaqsrfcgaeglnnvitlstfrnaeflqaygva
iadgplkglaaravvvidendnvifsqlvdeittepdyeaalavlka
Timeline for d3hvsb_: