Lineage for d3hvsb_ (3hvs B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877709Protein Thiol peroxidase Tpx [102452] (4 species)
  7. 2877710Species Escherichia coli K-12 [TaxId:83333] [189089] (4 PDB entries)
  8. 2877713Domain d3hvsb_: 3hvs B: [177878]
    automated match to d1qxha_
    complexed with cit

Details for d3hvsb_

PDB Entry: 3hvs (more details), 1.8 Å

PDB Description: Escherichia coli Thiol peroxidase (Tpx) wild type disulfide form
PDB Compounds: (B:) Thiol Peroxidase

SCOPe Domain Sequences for d3hvsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hvsb_ c.47.1.10 (B:) Thiol peroxidase Tpx {Escherichia coli K-12 [TaxId: 83333]}
sqtvhfqgnpvtvansipqagskaqtftlvakdlsdvtlgqfagkrkvlnifpsidtgvc
aasvrkfnqlateidntvvlcisadlpfaqsrfcgaeglnnvitlstfrnaeflqaygva
iadgplkglaaravvvidendnvifsqlvdeittepdyeaalavlka

SCOPe Domain Coordinates for d3hvsb_:

Click to download the PDB-style file with coordinates for d3hvsb_.
(The format of our PDB-style files is described here.)

Timeline for d3hvsb_: