Lineage for d3hvma_ (3hvm A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974297Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2974298Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2974383Family d.126.1.6: Porphyromonas-type peptidylarginine deiminase [111155] (3 proteins)
    Pfam PF04371; functionally related to the amidinotransferase, similar active site
  6. 2974399Protein Putative peptidyl-arginine deiminase [111158] (3 species)
  7. 2974402Species Helicobacter pylori J99 [TaxId:85963] [111159] (2 PDB entries)
    Uniprot Q9ZN18
  8. 2974403Domain d3hvma_: 3hvm A: [177874]
    automated match to d2cmua1

Details for d3hvma_

PDB Entry: 3hvm (more details), 2.1 Å

PDB Description: agmatine deiminase from helicobacter pylori
PDB Compounds: (A:) agmatine deiminase

SCOPe Domain Sequences for d3hvma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hvma_ d.126.1.6 (A:) Putative peptidyl-arginine deiminase {Helicobacter pylori J99 [TaxId: 85963]}
mkrmlaefekiqailmafphefsdwaycikearesflniiqtiakhakvlvcvhtndtig
yemlknlpgveiakvdtndtwardfgaisienhgvlecldfgfngwglkypsnldnqvnf
klkslgflkhplktmpyvleggsiesdgagsiltntqclleknrnphlnqngietmlkke
lgakqvlwysygylkgddtdshtdtlarfldkdtivysacedkndehytalkkmqeelkt
fkkldktpyklipleipkaifdenqqrlpatyvnfllcndalivptyndpkdaliletlk
qhtplevigvdcntlikqhgslhcvtmqly

SCOPe Domain Coordinates for d3hvma_:

Click to download the PDB-style file with coordinates for d3hvma_.
(The format of our PDB-style files is described here.)

Timeline for d3hvma_: