Lineage for d3hvka_ (3hvk A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892671Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 2892847Protein automated matches [190251] (6 species)
    not a true protein
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187033] (8 PDB entries)
  8. 2892873Domain d3hvka_: 3hvk A: [177873]
    automated match to d1h1da_
    complexed with 719, cl, mg, nhe

Details for d3hvka_

PDB Entry: 3hvk (more details), 1.3 Å

PDB Description: rat catechol o-methyltransferase in complex with a catechol-type, purine-containing bisubstrate inhibitor - humanized form
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d3hvka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hvka_ c.66.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv
lelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdl
ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay
vrgsssfecthyssyleymkvvdglekaiyqgp

SCOPe Domain Coordinates for d3hvka_:

Click to download the PDB-style file with coordinates for d3hvka_.
(The format of our PDB-style files is described here.)

Timeline for d3hvka_: