Lineage for d3hvjb_ (3hvj B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2145091Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 2145260Protein automated matches [190251] (5 species)
    not a true protein
  7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187033] (9 PDB entries)
  8. 2145276Domain d3hvjb_: 3hvj B: [177872]
    automated match to d1h1da_
    complexed with 705, btb, cl, mg

Details for d3hvjb_

PDB Entry: 3hvj (more details), 1.79 Å

PDB Description: rat catechol o-methyltransferase in complex with a catechol-type, n6- propyladenine-containing bisubstrate inhibitor
PDB Compounds: (B:) Catechol O-methyltransferase

SCOPe Domain Sequences for d3hvjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hvjb_ c.66.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspsl
vlelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqd
lipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdfla
yvrgsssfecthyssyleymkvvdglekaiyqgp

SCOPe Domain Coordinates for d3hvjb_:

Click to download the PDB-style file with coordinates for d3hvjb_.
(The format of our PDB-style files is described here.)

Timeline for d3hvjb_: