Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) |
Family c.66.1.1: COMT-like [53336] (4 proteins) |
Protein automated matches [190251] (5 species) not a true protein |
Domain d3hvjb_: 3hvj B: [177872] automated match to d1h1da_ complexed with 705, btb, cl, mg |
PDB Entry: 3hvj (more details), 1.79 Å
SCOPe Domain Sequences for d3hvjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hvjb_ c.66.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} gdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspsl vlelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqd lipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdfla yvrgsssfecthyssyleymkvvdglekaiyqgp
Timeline for d3hvjb_: