![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) ![]() |
![]() | Family c.66.1.1: COMT-like [53336] (4 proteins) |
![]() | Protein automated matches [190251] (6 species) not a true protein |
![]() | Domain d3hvia_: 3hvi A: [177870] automated match to d1h1da_ complexed with 619, cl, d1d, mg, na |
PDB Entry: 3hvi (more details), 1.2 Å
SCOPe Domain Sequences for d3hvia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hvia_ c.66.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv lelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdl ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay vrgsssfecthyssyleymkvvdglekaiyqgp
Timeline for d3hvia_: