![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) ![]() |
![]() | Family c.66.1.1: COMT-like [53336] (4 proteins) |
![]() | Protein automated matches [190251] (6 species) not a true protein |
![]() | Domain d3hvha_: 3hvh A: [177869] automated match to d1h1da_ complexed with 542, cl, cxs, mg, so4 |
PDB Entry: 3hvh (more details), 1.3 Å
SCOPe Domain Sequences for d3hvha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hvha_ c.66.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspslv lelgaycgysavrmarllqpgarlltmemnpdyaaitqqmlnfaglqdkvtilngasqdl ipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflay vrgsssfecthyssyleymkvvdglekaiyqgp
Timeline for d3hvha_: