Lineage for d3hv0a_ (3hv0 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (50 species)
    not a true protein
  7. 2106074Species Cryptosporidium parvum [TaxId:353152] [188948] (1 PDB entry)
  8. 2106075Domain d3hv0a_: 3hv0 A: [177854]
    automated match to d1ulhb_
    complexed with trp

Details for d3hv0a_

PDB Entry: 3hv0 (more details), 2.42 Å

PDB Description: Tryptophanyl-tRNA synthetase from Cryptosporidium parvum
PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d3hv0a_:

Sequence, based on SEQRES records: (download)

>d3hv0a_ c.26.1.0 (A:) automated matches {Cryptosporidium parvum [TaxId: 353152]}
nklidkfgcklitkdmiermerltgqkahhffrrniflshrdfekildvyekgelfylyt
grgpsseslhvghlvpflftkylqdtfkvplviqltddekfifksnltleethnyayenm
kdiiacgfdpeltfiftnleyiaelypdilriekkiscsqiksifgfkdscnvgkfafpa
vqaapafsssfphifggrtdihclvphaidqdpyfrmvrdvaprlgylkpssihsiflps
lqgsqtkmsasvqnssifvndneesirnkimkyafsggqateeeqrrlganldvdvswqy
lrflmeddekleeigkkyssgemlsgeiksilvqelvkltknhqknreainddviakftn
ksreqllk

Sequence, based on observed residues (ATOM records): (download)

>d3hv0a_ c.26.1.0 (A:) automated matches {Cryptosporidium parvum [TaxId: 353152]}
nklidkfgcklitkdmiermerltgqkahhffrrniflshrdfekildvyekgelfylyt
grgpsseslhvghlvpflftkylqdtfkvplviqltddekfifksnltleethnyayenm
kdiiacgfdpeltfiftnleyiaelypdilriekkiscsqiksifgfkdscnvgkfafpa
vqaapafsssfphifggrtdihclvphaidqdpyfrmvrdvaprlgylkpssihsiflps
nssifvndneesirnkimkyafsggqateeeqganldvdvswqylrflmeddekleeigk
kyssgemlsgeiksilvqelvkltknhqknreainddviakftnksreqllk

SCOPe Domain Coordinates for d3hv0a_:

Click to download the PDB-style file with coordinates for d3hv0a_.
(The format of our PDB-style files is described here.)

Timeline for d3hv0a_: