Lineage for d3huka_ (3huk A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2495000Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2495001Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2496244Family d.2.1.3: Phage lysozyme [53981] (4 protein domains)
  6. 2496250Protein Phage T4 lysozyme [53982] (1 species)
  7. 2496251Species Bacteriophage T4 [TaxId:10665] [53983] (572 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 2496301Domain d3huka_: 3huk A: [177847]
    automated match to d1l19a_
    complexed with bme, j0z, po4

Details for d3huka_

PDB Entry: 3huk (more details), 1.29 Å

PDB Description: benzylacetate in complex with t4 lysozyme l99a/m102q
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d3huka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3huka_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspdlnaakseldkaigrncngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcaainqvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpdrakrvittfrtgtwdayk

SCOPe Domain Coordinates for d3huka_:

Click to download the PDB-style file with coordinates for d3huka_.
(The format of our PDB-style files is described here.)

Timeline for d3huka_: