Class b: All beta proteins [48724] (178 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (21 species) not a true protein |
Species Influenza A virus (a/wdk/jx/12416/2005(h1n1)) [TaxId:666057] [188994] (4 PDB entries) |
Domain d3htta_: 3htt A: [177838] Other proteins in same PDB: d3httb_ automated match to d1rd8a_ complexed with nag |
PDB Entry: 3htt (more details), 2.95 Å
SCOPe Domain Sequences for d3htta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3htta_ b.19.1.2 (A:) automated matches {Influenza A virus (a/wdk/jx/12416/2005(h1n1)) [TaxId: 666057]} dticigyhannstdtvdtvleknvtvthsvnllednhngklcklngiaplqlgkcnvagw llgnpecdllltanswsyiietsnsengtcypgefidyeelreqlssvssferfeifpka sswpnhettkgvtaacsyfgassfyrnllwitkkgtsypklsksytnnkgkevlvlwgvh hppttseqqtlyqntdayvsvgsskynrrftpeiaarpkvrgqagrmnyywtlldqgdti tfeatgnliapwyafalnkgsdsgiitsdapvhncdtkcqtphgainstlpfqnvhpiti gecpkyvkstklrmatglrnipsi
Timeline for d3htta_: