Lineage for d3htta_ (3htt A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2385148Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2385149Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2385196Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2385678Protein automated matches [190291] (21 species)
    not a true protein
  7. 2385775Species Influenza A virus (a/wdk/jx/12416/2005(h1n1)) [TaxId:666057] [188994] (4 PDB entries)
  8. 2385776Domain d3htta_: 3htt A: [177838]
    Other proteins in same PDB: d3httb_
    automated match to d1rd8a_
    complexed with nag

Details for d3htta_

PDB Entry: 3htt (more details), 2.95 Å

PDB Description: the hemagglutinin structure of an avian h1n1 influenza a virus in complex with 2,3-sialyllactose
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d3htta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3htta_ b.19.1.2 (A:) automated matches {Influenza A virus (a/wdk/jx/12416/2005(h1n1)) [TaxId: 666057]}
dticigyhannstdtvdtvleknvtvthsvnllednhngklcklngiaplqlgkcnvagw
llgnpecdllltanswsyiietsnsengtcypgefidyeelreqlssvssferfeifpka
sswpnhettkgvtaacsyfgassfyrnllwitkkgtsypklsksytnnkgkevlvlwgvh
hppttseqqtlyqntdayvsvgsskynrrftpeiaarpkvrgqagrmnyywtlldqgdti
tfeatgnliapwyafalnkgsdsgiitsdapvhncdtkcqtphgainstlpfqnvhpiti
gecpkyvkstklrmatglrnipsi

SCOPe Domain Coordinates for d3htta_:

Click to download the PDB-style file with coordinates for d3htta_.
(The format of our PDB-style files is described here.)

Timeline for d3htta_: