Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (23 species) not a true protein |
Species Influenza a virus (a/wdk/jx/12416/2005(h1n1)) [TaxId:666057] [188994] (4 PDB entries) |
Domain d3htqa_: 3htq A: [177837] Other proteins in same PDB: d3htqb_ automated match to d1rd8a_ complexed with nag |
PDB Entry: 3htq (more details), 2.96 Å
SCOPe Domain Sequences for d3htqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3htqa_ b.19.1.2 (A:) automated matches {Influenza a virus (a/wdk/jx/12416/2005(h1n1)) [TaxId: 666057]} dticigyhannstdtvdtvleknvtvthsvnllednhngklcklngiaplqlgkcnvagw llgnpecdllltanswsyiietsnsengtcypgefidyeelreqlssvssferfeifpka sswpnhettkgvtaacsyfgassfyrnllwitkkgtsypklsksytnnkgkevlvlwgvh hppttseqqtlyqntdayvsvgsskynrrftpeiaarpkvrgqagrmnyywtlldqgdti tfeatgnliapwyafalnkgsdsgiitsdapvhncdtkcqtphgainstlpfqnvhpiti gecpkyvkstklrmatglrnipsi
Timeline for d3htqa_: