SCOPe 2.08: Domain d3htpa_: 3htp A:

Lineage for d3htpa_ (3htp A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (19 species)
   not a true protein

7. Species Influenza A virus (a/wdk/jx/12416/2005(h1n1)) [TaxId:666057] [188994] (4 PDB entries)

8. Domain d3htpa_: 3htp A: [177836]
   Other proteins in same PDB: d3htpb_
   automated match to d1rd8a_
   complexed with nag

Details for d3htpa_

PDB Entry: 3htp, 2.96 Å

PDB Description: the hemagglutinin structure of an avian h1n1 influenza a virus in complex with lsta

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d3htpa_:

Sequence; same for both SEQRES and ATOM records:

>d3htpa_ b.19.1.2 (A:) automated matches {Influenza A virus (a/wdk/jx/12416/2005(h1n1)) [TaxId: 666057]}
dticigyhannstdtvdtvleknvtvthsvnllednhngklcklngiaplqlgkcnvagw
llgnpecdllltanswsyiietsnsengtcypgefidyeelreqlssvssferfeifpka
sswpnhettkgvtaacsyfgassfyrnllwitkkgtsypklsksytnnkgkevlvlwgvh
hppttseqqtlyqntdayvsvgsskynrrftpeiaarpkvrgqagrmnyywtlldqgdti
tfeatgnliapwyafalnkgsdsgiitsdapvhncdtkcqtphgainstlpfqnvhpiti
gecpkyvkstklrmatglrnipsi

Timeline for d3htpa_:

• d3htpa_ first appeared in SCOPe 2.01
  
• d3htpa_ appears in SCOPe 2.07